DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and PEX1

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_012724.1 Gene:PEX1 / 853636 SGDID:S000001680 Length:1043 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:78/237 - (32%)
Similarity:126/237 - (53%) Gaps:18/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 VEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAK---GLLLFGPPGNGKTLLARAVATECS 541
            ::|.||.....||..|.|.:..|:....:|  :..|.:   |:||:|.||.||||||.|||.:|.
Yeast   694 IKWGDIGALANAKDVLLETLEWPTKYEPIF--VNCPLRLRSGILLYGYPGCGKTLLASAVAQQCG 756

  Fly   542 ATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEF 606
            ..|:::....:.:|::|..|:.:|.||..|:.::|.|:|.||.||:..:|.......:.|:..:.
Yeast   757 LNFISVKGPEILNKFIGASEQNIRELFERAQSVKPCILFFDEFDSIAPKRGHDSTGVTDRVVNQL 821

  Fly   607 LVEFDGLPGNPDGDRIVVLAATNRPQELDEAALR--RFTKRVYVSLPDEQTRELLLNRLL----- 664
            |.:.||..|.   |.:.:||||:||..:|.|.||  |..|.|..::|.|..|..:|..::     
Yeast   822 LTQMDGAEGL---DGVYILAATSRPDLIDSALLRPGRLDKSVICNIPTESERLDILQAIVNSKDK 883

  Fly   665 ---QKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPI 703
               ||:.:......|:.:|:.|.|:||:||..|..:|.|:.:
Yeast   884 DTGQKKFALEKNADLKLIAEKTAGFSGADLQGLCYNAYLKSV 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 24/58 (41%)
AAA 515..652 CDD:214640 52/141 (37%)
AAA 519..650 CDD:278434 50/132 (38%)
Vps4_C <722..754 CDD:286426
PEX1NP_012724.1 PEX-1N 108..183 CDD:401267
SpoVK 457..929 CDD:223540 78/237 (33%)
RecA-like_PEX1_r2 705..862 CDD:410934 58/161 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.