DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and ATAD1

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001308896.1 Gene:ATAD1 / 84896 HGNCID:25903 Length:361 Species:Homo sapiens


Alignment Length:293 Identity:115/293 - (39%)
Similarity:179/293 - (61%) Gaps:19/293 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 VSVKGV-----EQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLR-- 513
            :.||.|     |..:...::|.:   ...|.|:||||.|.....|::.||||..:..||...|  
Human    62 IGVKNVKLSEYEMSIAAHLVDPL---NMHVTWSDIAGLDDVITDLKDTVILPIKKKHLFENSRLL 123

  Fly   514 APAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSI 578
            .|.||:||:||||.||||:|:|.|.|....|:|:..::||.|:.|:.:||..|:|::|..:||||
Human   124 QPPKGVLLYGPPGCGKTLIAKATAKEAGCRFINLQPSTLTDKWYGESQKLAAAVFSLAIKLQPSI 188

  Fly   579 IFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGD---RIVVLAATNRPQELDEAALR 640
            |||||:||.|..||||:|||:..:|.:|:..:|||    |.|   :::|:.||||||:||.|.:|
Human   189 IFIDEIDSFLRNRSSSDHEATAMMKAQFMSLWDGL----DTDHSCQVIVMGATNRPQDLDSAIMR 249

  Fly   641 RFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRE 705
            |...|.:::.|..:.||.:|..:|:.:......:.| .:|:.|||:|||||..:.:||||..:||
Human   250 RMPTRFHINQPALKQREAILKLILKNENVDRHVDLL-EVAQETDGFSGSDLKEMCRDAALLCVRE 313

  Fly   706 -LNVEQVKCLDISAMRAITEQDFHSSLKRIRRS 737
             :|....:..|...:|.:.:||.|.:::::::|
Human   314 YVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 29/57 (51%)
AAA 515..652 CDD:214640 67/139 (48%)
AAA 519..650 CDD:278434 64/133 (48%)
Vps4_C <722..754 CDD:286426 4/16 (25%)
ATAD1NP_001308896.1 RecA-like_ATAD1 92..257 CDD:410928 80/168 (48%)
AAA_lid_3 282..321 CDD:407720 17/39 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.