DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and KATNAL1

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001014402.1 Gene:KATNAL1 / 84056 HGNCID:28361 Length:490 Species:Homo sapiens


Alignment Length:390 Identity:154/390 - (39%)
Similarity:223/390 - (57%) Gaps:52/390 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 PAKTAATPPAVRRQFSSGRNTPPQRSRTPINNNGPSG---------------------------- 448
            ||:..| ||.:||.....|  |.::....:...||.|                            
Human   104 PAEHRA-PPQIRRPNREVR--PLRKEMAGVGARGPVGRAHPISKSEKPSTSRDKDYRARGRDDKG 165

  Fly   449 -----SGAS---TPVVSVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVR 505
                 .|||   .|.....|.::.||:.:..:||.....:.|.|||..:.||:.|:|.|:||...
Human   166 RKNMQDGASDGEMPKFDGAGYDKDLVEALERDIVSRNPSIHWDDIADLEEAKKLLREAVVLPMWM 230

  Fly   506 PELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAV 570
            |:.|.|:|.|.||:|:.||||.|||:||:||||||..||.|:|:::|||||.|:.|||||.||.:
Human   231 PDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEM 295

  Fly   571 ARHMQPSIIFIDEVDSLLSER-SSSEHEASRRLKTEFLVEFDGLPG---NPDGDRIV-VLAATNR 630
            ||...|:.|||||:||:.|.| :|.|||||||:|:|.|::.||:.|   |.|..::| ||||||.
Human   296 ARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSKMVMVLAATNF 360

  Fly   631 PQELDEAALRRFTKRVYVSLPDEQTR-ELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTAL 694
            |.::|||..||..||:|:.||..:.| |||...|.:.:..| |.: |..:|:..:||||:|:|.:
Human   361 PWDIDEALRRRLEKRIYIPLPTAKGRAELLKINLREVELDP-DIQ-LEDIAEKIEGYSGADITNV 423

  Fly   695 AKDAALEPIRE----LNVEQVKCLDISAMR-AITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYG 754
            .:||:|..:|.    |:.|:::.|....:: .:|:.||..:||:|.:||:...|..||||..::|
Human   424 CRDASLMAMRRRINGLSPEEIRALSKEELQMPVTKGDFELALKKIAKSVSAADLEKYEKWMVEFG 488

  Fly   755  754
            Human   489  488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 30/55 (55%)
AAA 515..652 CDD:214640 81/141 (57%)
AAA 519..650 CDD:278434 77/135 (57%)
Vps4_C <722..754 CDD:286426 13/31 (42%)
KATNAL1NP_001014402.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..184 16/82 (20%)
SpoVK <188..483 CDD:223540 134/296 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.