DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and EMB2083

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_566541.1 Gene:EMB2083 / 820876 AraportID:AT3G16290 Length:876 Species:Arabidopsis thaliana


Alignment Length:543 Identity:129/543 - (23%)
Similarity:213/543 - (39%) Gaps:150/543 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 RRAFEYISKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNL 298
            |...|...||.|..:|.:..|.:..:.|.:.::|....     :....|:|.|..:     ..|:
plant   250 RVMMEKTMKAQKKQQERKKRKAVRKKKYEESLREARKN-----YRDMADMWARLAQ-----DPNV 304

  Fly   299 SMARDRLHF--------LALREQDLQMQ-RLSLKEKQKEEAQSKPQKTREPMLAGMTNEPMKLRV 354
            :.|...:.|        |..|:|....: ||.:::.:.:|.:...:..||  :.|:..|..::..
plant   305 ATALGLVFFYIFYRVVVLNYRKQKKDYEDRLKIEKAEADERKKMRELERE--MEGIEEEDEEVEE 367

  Fly   355 RSSGYGPKATTSAQPTASGRKLTIGSKRPVNLAVANKSQTLPRNLGSKTSVGAVQRQPAKTAATP 419
            .:....|....:.|...||.:                                            
plant   368 GTGEKNPYLQMAMQFMKSGAR-------------------------------------------- 388

  Fly   420 PAVRRQFSSGRNTPPQRSRTPINNNGPSGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKVEWTD 484
              |||  :|.:..|                                      |.:|.|..|::||
plant   389 --VRR--ASNKRLP--------------------------------------EYLERGVDVKFTD 411

  Fly   485 IAGQDVAKQALQEMVILPSVRPELFT--------GLRAPAKGLLLFGPPGNGKTLLARAVATECS 541
            :||....:..|:|:|       :.||        |::.|. |:||.||||.||||||:|||.|..
plant   412 VAGLGKIRLELEEIV-------KFFTHGEMYRRRGVKIPG-GILLCGPPGVGKTLLAKAVAGEAG 468

  Fly   542 ATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSER------SSSEHEASR 600
            ..|.:|||:.....|||.|...||||:..||...||::||||:|::..||      ...|.:|: 
plant   469 VNFFSISASQFVEIYVGVGASRVRALYQEARENAPSVVFIDELDAVGRERGLIKGSGGQERDAT- 532

  Fly   601 RLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALR--RFTKRVYVSLPDEQTRELLLNRL 663
              ..:.||..||..|..:   ::.:|:||||..||.|.:|  ||.:::::..|....|..:|...
plant   533 --LNQLLVSLDGFEGRGE---VITIASTNRPDILDPALVRPGRFDRKIFIPKPGLIGRMEILQVH 592

  Fly   664 LQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITEQDFH 728
            .:|:....|.:.: .:|.:|||..|::|..:.:.||:..:|:...|            :|..|..
plant   593 ARKKPMAEDLDYM-AVASMTDGMVGAELANIVEIAAINMMRDGRTE------------LTTDDLL 644

  Fly   729 SSLKRIRRSVAPQSLNSYEKWSQ 751
            .:.:...|.:..:...|.|.|.|
plant   645 QAAQIEERGMLDRKDRSLETWRQ 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142 15/81 (19%)
P-loop_NTPase 482..>538 CDD:304359 26/63 (41%)
AAA 515..652 CDD:214640 59/144 (41%)
AAA 519..650 CDD:278434 57/138 (41%)
Vps4_C <722..754 CDD:286426 7/30 (23%)
EMB2083NP_566541.1 FtsH_fam 378..837 CDD:273520 103/403 (26%)
AAA 446..578 CDD:278434 57/137 (42%)
Peptidase_M41 666..832 CDD:279742 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.