DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and pex6

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_001332652.5 Gene:pex6 / 792998 ZFINID:ZDB-GENE-081104-252 Length:1071 Species:Danio rerio


Alignment Length:284 Identity:102/284 - (35%)
Similarity:157/284 - (55%) Gaps:22/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 VEWTDIAGQDVAKQALQEMVILPSVRPELFT-GLRAPAKGLLLFGPPGNGKTLLARAVATECSAT 543
            |.|.|:.|....|:.:.:.:.||...|||.: |||  ..||||:||||.||||||:||||||:.|
Zfish   793 VSWQDVGGLQQVKKEILDTIQLPLEHPELLSLGLR--RSGLLLYGPPGTGKTLLAKAVATECTMT 855

  Fly   544 FLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEAS--RRLKTEF 606
            ||::....|.:.|||..|:.:|.:.:.||...|.|||.||:|||...|..|.....  .|:.::.
Zfish   856 FLSVKGPELINMYVGQSEENIRQVSSKARSAAPCIIFFDELDSLAPNRGHSGDSGGVMDRVVSQL 920

  Fly   607 LVEFDGLPGNPDGDRIVVLAATNRPQELDEAALR--RFTKRVYVSLPDEQTREL-LLNRLLQKQG 668
            |.|.|||..:.|   :.|:.|||||..||::.||  ||.|.|||.:.:::..:| :|..:|:|  
Zfish   921 LAELDGLHSSGD---VFVIGATNRPDLLDQSLLRPGRFDKLVYVGINEDRESQLQVLKAILRK-- 980

  Fly   669 SPLDTEALRRLAKITDG----YSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAIT--EQDF 727
              ...:|...|:.|.:.    .:|:||.:|..||.:..::.......:.:| |.:.::|  .:||
Zfish   981 --FKVDASVCLSDIVESCPPRLTGADLYSLCSDAMMCAVKRKISRITEGVD-SELSSLTLCSEDF 1042

  Fly   728 HSSLKRIRRSVAPQSLNSYEKWSQ 751
            ..:|..::.||:.|.::.|:...|
Zfish  1043 SEALSGLQPSVSEQQISRYQLLQQ 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 28/56 (50%)
AAA 515..652 CDD:214640 65/140 (46%)
AAA 519..650 CDD:278434 64/134 (48%)
Vps4_C <722..754 CDD:286426 9/32 (28%)
pex6XP_001332652.5 SpoVK 561..1060 CDD:223540 100/276 (36%)
P-loop_NTPase 562..>620 CDD:304359
AAA 834..962 CDD:278434 60/130 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.