DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and SPG7

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001350779.1 Gene:SPG7 / 6687 HGNCID:11237 Length:809 Species:Homo sapiens


Alignment Length:287 Identity:104/287 - (36%)
Similarity:151/287 - (52%) Gaps:36/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 IVEG--GAKVEWTDIAGQDVAKQALQEMV-ILPSVRPELF--TGLRAPAKGLLLFGPPGNGKTLL 532
            ||:|  |..|.:.|:||...||..::|.| .|.|  ||.|  .|.:.| ||.||.||||.|||||
Human   297 IVDGKMGKGVSFKDVAGMHEAKLEVREFVDYLKS--PERFLQLGAKVP-KGALLLGPPGCGKTLL 358

  Fly   533 ARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSS---- 593
            |:|||||....||.::.........|.|...||:||..||...|.|::|||:|::..:||:    
Human   359 AKAVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTTMSG 423

  Fly   594 -SEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALR--RFTKRVYVSLPD-EQ 654
             |..|..:.| .:.|||.||:...   |.::|||:|||...||.|.:|  |..:.|::.||. ::
Human   424 FSNTEEEQTL-NQLLVEMDGMGTT---DHVIVLASTNRADILDGALMRPGRLDRHVFIDLPTLQE 484

  Fly   655 TRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRE-------LN----V 708
            .||:....|...:.:...|...:|||::|.|:||:|:..:..:|||...||       ||    |
Human   485 RREIFEQHLKSLKLTQSSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTLNFEYAV 549

  Fly   709 EQVKCLDISAMRAITEQD-----FHSS 730
            |:|........:.:::::     ||.|
Human   550 ERVLAGTAKKSKILSKEEQKVVAFHES 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 30/58 (52%)
AAA 515..652 CDD:214640 60/143 (42%)
AAA 519..650 CDD:278434 56/137 (41%)
Vps4_C <722..754 CDD:286426 3/14 (21%)
SPG7NP_001350779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..133
FtsH_ext 145..242 CDD:310823
TIP49 265..729 CDD:332389 104/287 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.