DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and FIGNL1

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001036227.1 Gene:FIGNL1 / 63979 HGNCID:13286 Length:674 Species:Homo sapiens


Alignment Length:404 Identity:170/404 - (42%)
Similarity:251/404 - (62%) Gaps:26/404 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 GPKATTSAQPTASGRKLTIGSKRPVNLAVANKSQTLPRNLGSKTSVGAVQRQPAKTAATPPAVRR 424
            |||..:|. ||....|        ..|.|..:.:.......|.:|.|.|::...       |.|.
Human   285 GPKEDSSL-PTFKTAK--------EQLWVDQQKKYHQPQRASGSSYGGVKKSLG-------ASRS 333

  Fly   425 QFSSGRNTPPQRSRTPINNNG-----PSGSGASTPVVSV----KGVEQKLVQLILDEIVEGGAKV 480
            :...|:..||...:.....||     |.|:|.:.|...|    |.:|.|:::||::||::.|..|
Human   334 RGILGKFVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPVDERLKNLEPKMIELIMNEIMDHGPPV 398

  Fly   481 EWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFL 545
            .|.||||.:.||..::|:|:.|.:||::|||||.|.||:|||||||.||||:.:.:|::..|||.
Human   399 NWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFF 463

  Fly   546 NISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEF 610
            :|||:|||||:||:|||:|||||||||..||::|||||:|||||:|...|||:|||:||||||:.
Human   464 SISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQL 528

  Fly   611 DGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEA 675
            ||...:.: |||:|:.|||||||:||||.||..||:|:.||:...|:.::..|:.|:...|..|.
Human   529 DGATTSSE-DRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEE 592

  Fly   676 LRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITEQDFHSSLKRIRRSVAP 740
            :.::.:.:|.:||:|:|.|.::|:|.|||.|....:..:....:|.|...||.::.:.:|.||:|
Human   593 IEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSP 657

  Fly   741 QSLNSYEKWSQDYG 754
            :.|..||.|::.:|
Human   658 KDLELYENWNKTFG 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 31/55 (56%)
AAA 515..652 CDD:214640 88/136 (65%)
AAA 519..650 CDD:278434 84/130 (65%)
Vps4_C <722..754 CDD:286426 11/31 (35%)
FIGNL1NP_001036227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..179
Necessary and sufficient for interaction with RAD51. /evidence=ECO:0000305|PubMed:23754376 295..344 11/63 (17%)
SpoVK <374..668 CDD:223540 144/294 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1176820at2759
OrthoFinder 1 1.000 - - FOG0001088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100722
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.