DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and Pex1

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001102690.1 Gene:Pex1 / 500006 RGDID:1559939 Length:1283 Species:Rattus norvegicus


Alignment Length:228 Identity:86/228 - (37%)
Similarity:125/228 - (54%) Gaps:11/228 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 WTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAK---GLLLFGPPGNGKTLLARAVATECSAT 543
            |..|.|....:|.|.:.:.||:..||||..|  |.:   |:||:||||.||||||..||.|....
  Rat   839 WDKIGGLHEVRQILMDTIQLPAKYPELFANL--PIRQRTGILLYGPPGTGKTLLAGVVARESGMN 901

  Fly   544 FLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLV 608
            |::|....|.|||:|..|:.||.:|..|:..:|.|:|.||.:|:...|.......:.|:..:.|.
  Rat   902 FISIQGPELLSKYIGASEQAVRDVFIRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRVVNQLLT 966

  Fly   609 EFDGLPGNPDGDRIVVLAATNRPQELDEAALR--RFTKRVYVSLPDEQTRELLLNRLLQKQGSPL 671
            :.||:.|.   ..:.|||||:||..:|.|.||  |..|.||...||:.:|..:|. :|.|.....
  Rat   967 QLDGVEGL---QGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILT-VLSKSLPLA 1027

  Fly   672 DTEALRRLAKITDGYSGSDLTALAKDAALEPIR 704
            |...|:.:|.:|:.::|:||.||..:|.||.::
  Rat  1028 DDVDLQHVASVTESFTGADLKALLYNAQLEALQ 1060

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 27/58 (47%)
AAA 515..652 CDD:214640 56/141 (40%)
AAA 519..650 CDD:278434 54/132 (41%)
Vps4_C <722..754 CDD:286426
Pex1NP_001102690.1 PEX-2N 19..98 CDD:286362
PEX-1N 104..179 CDD:286361
AAA 591..741 CDD:214640
AAA 595..724 CDD:278434
AAA 877..1009 CDD:214640 54/134 (40%)
AAA 877..1006 CDD:278434 54/131 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.