DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and nmd

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster


Alignment Length:288 Identity:113/288 - (39%)
Similarity:177/288 - (61%) Gaps:12/288 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 VKGVEQKLVQLILDE--IVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLR---APAK 517
            ::|.|....:|::..  :|.....|.|.||||.|...|.|:|.|:||....:||...:   || |
  Fly    70 LRGQEFSDYELMIASHLVVPADITVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAP-K 133

  Fly   518 GLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFID 582
            |:||.||||.||||:|:|.|.|....|:|:..|.||.|:.|:.:||..|:|::|..::|.|||||
  Fly   134 GVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFID 198

  Fly   583 EVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVY 647
            |:||.|..|:.::|||:..:||:|::.:|||..|.: ..::|:.||||||:||:|.:||...:.:
  Fly   199 EIDSFLRSRNMNDHEATAMMKTQFMMLWDGLSTNAN-STVIVMGATNRPQDLDKAIVRRMPAQFH 262

  Fly   648 VSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQ-- 710
            :.||.|..|:.:|..:||.:....|.: |.||:|:|:|:|||||..:.::|::..:|:|...:  
  Fly   263 IGLPSETQRKDILKLILQSEEVSQDVD-LNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDP 326

  Fly   711 -VKCLDISAMRAITEQDFHSSLKRIRRS 737
             ...||.:.:| ||..|...|..:|:.|
  Fly   327 SATALDRNNVR-ITMDDLLGSHLKIKES 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 30/58 (52%)
AAA 515..652 CDD:214640 63/136 (46%)
AAA 519..650 CDD:278434 59/130 (45%)
Vps4_C <722..754 CDD:286426 6/16 (38%)
nmdNP_001285801.1 AAA 132..266 CDD:214640 62/135 (46%)
AAA 135..265 CDD:278434 59/130 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.