DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and pch2

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster


Alignment Length:425 Identity:102/425 - (24%)
Similarity:161/425 - (37%) Gaps:117/425 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 AVANKSQT-----------LPRNLGSKTSVGAVQR---------------QPAKTAATPPAVRRQ 425
            |:.|..:|           ||||:.....:.|.|.               ||.|.|.|  ..|..
  Fly    25 AIRNNVETALKAYFQTARKLPRNVSFLPDLTAEQTEHVHSVLLERDNGGVQPLKVAET--KFRFH 87

  Fly   426 FSSGRNTPPQRSRTPI--NNNGPSG-------SGASTPVVSVKGVEQKLVQLILDEIVEGGAKVE 481
            |.:   |.|:..:..:  ...|..|       |.|..|.....|:.:.|       |.|.|.|  
  Fly    88 FYA---TRPEEGQLGLFSGEEGSDGIDSIVAASHALLPAAQFVGLWENL-------IYETGLK-- 140

  Fly   482 WTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECS----- 541
                  :.:.|.||..::.   ....:.|.:.|..:.:||.||||.|||.|.:|:|.:.|     
  Fly   141 ------EKLLKFALSALMF---SEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIRTQG 196

  Fly   542 ----ATFLNISAASLTSKYVGDGEKLVRALFAVARHM--QPS---IIFIDEVDSLL---SERSSS 594
                ...:.|::.||.||:..:..|||..||.....:  .|:   .:.||||:||.   |..||:
  Fly   197 SYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVLIDEVESLAYARSAMSSN 261

  Fly   595 EHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLP-------- 651
            |...:.|:....|.:.|.|...|:   :::||.:|..|.:|.|.:.|...|:::..|        
  Fly   262 EPRDAMRVVNAVLTQLDSLKTCPN---VLILATSNLAQSIDLAFVDRADIRLFIGYPGISAIREI 323

  Fly   652 --------------------DEQTRELLLNRLLQKQGSPLDTEALRRLAKITDG-YSGSDLTALA 695
                                .|...|.||.:|.::... |....||:|..:... |:.|.|..|.
  Fly   324 YKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVG-LSGRTLRKLPLLAHAQYTSSTLFELD 387

  Fly   696 K--------DAALEPIRELNVEQVKCLDISAMRAI 722
            :        ||.||.: |.::.:.:.|.:.:|..:
  Fly   388 QKISLSDFLDAMLEAL-EQHLGEQRLLKLESMEQL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 16/55 (29%)
AAA 515..652 CDD:214640 48/181 (27%)
AAA 519..650 CDD:278434 47/147 (32%)
Vps4_C <722..754 CDD:286426 0/1 (0%)
pch2NP_001287235.1 AAA 166..315 CDD:214640 47/151 (31%)
AAA 169..314 CDD:278434 47/147 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.