DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and trip13

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_956876.1 Gene:trip13 / 393554 ZFINID:ZDB-GENE-040426-1488 Length:424 Species:Danio rerio


Alignment Length:301 Identity:72/301 - (23%)
Similarity:128/301 - (42%) Gaps:79/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 INNNGPSG---------SGAS---TPVVSVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQ 493
            :|::.||.         |.|:   .|.|...||.:.|       |.|.|.|.:            
Zfish    95 LNDDSPSTLNLEEEEELSAANLWLLPAVEFHGVWESL-------IYEEGIKTQ------------ 140

  Fly   494 ALQEMVILPSVRPELF-------TGLRAPAKGLLLFGPPGNGKTLLARAVATECS---------A 542
                  :|..|...:|       :.|.|..:.:||.||||.|||.|.:.:|.:.|         :
Zfish   141 ------LLDYVSTTIFFSDKNVDSNLIAWNRVVLLHGPPGTGKTSLCKGLAQKLSIRLSDRYAHS 199

  Fly   543 TFLNISAASLTSKYVGDGEKLVRALFAVARHM---QPSIIF--IDEVDSLLSERSS----SEHEA 598
            .|:.|::.||.||:..:..|||..:|...:.:   :.:::|  ||||:||.:.||:    :|...
Zfish   200 QFVEINSHSLFSKWFSESGKLVTKMFQKIQELIDDKDALVFVLIDEVESLTAARSAAQAGTEPSD 264

  Fly   599 SRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQT-------- 655
            :.|:....|.:.|.:..:|:   :|:|..:|..:::|.|.:.|...:.|:..|..:.        
Zfish   265 AIRVVNSVLTQLDQIKRHPN---VVILTTSNVTEKIDLAFVDRADIKQYIGPPSAKAIFNIYLSS 326

  Fly   656 -RELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALA 695
             .||:..:::..:...:..|.|.     |..:..||:|.|:
Zfish   327 LEELMKRQIIYPRQQLVSLEELE-----TMNFMESDVTRLS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 15/62 (24%)
AAA 515..652 CDD:214640 43/154 (28%)
AAA 519..650 CDD:278434 43/148 (29%)
Vps4_C <722..754 CDD:286426
trip13NP_956876.1 AAA 164..314 CDD:214640 43/152 (28%)
AAA 167..312 CDD:278434 43/147 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.