DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and Vps4

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001285396.1 Gene:Vps4 / 32777 FlyBaseID:FBgn0283469 Length:442 Species:Drosophila melanogaster


Alignment Length:331 Identity:138/331 - (41%)
Similarity:202/331 - (61%) Gaps:40/331 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 EQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPG 526
            ::||...:.|.||....||:|:|:||.|.||:||:|.||||...|:||||.|.|.||:|||||||
  Fly   111 KKKLQSKLEDAIVIEKPKVQWSDVAGLDAAKEALKEAVILPIKFPQLFTGKRIPWKGILLFGPPG 175

  Fly   527 NGKTLLARAVATECS-ATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSE 590
            .||:.||:|||||.: :||.::|::.|.||::|:.||||:.||.:||..:||||||||:||:.|.
  Fly   176 TGKSYLAKAVATEANRSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEIDSMCSA 240

  Fly   591 RSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQT 655
            ||.:|:::.||:||||||:..|: || |.|.|:||.|||.|..||.|..|||.||:|:.||:...
  Fly   241 RSDNENDSVRRIKTEFLVQMQGV-GN-DTDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPEAHA 303

  Fly   656 RELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIREL-------------- 706
            |.::....|......|..:.|:.||..|:||||:|::.:.:||.:||:|::              
  Fly   304 RLVMFKIHLGNTTHVLTEQDLKELAGKTEGYSGADISIVVRDALMEPVRKVQTATHFKRVSGPSP 368

  Fly   707 -NVEQ------VKC------------LDISAMR----AITEQDFHSSLKRIRRSVAPQSLNSYEK 748
             |.|:      |.|            :|:.:.:    .:|.:|...||.|.:.:|....|....|
  Fly   369 TNHEEIVNDLLVPCSPGDQGAVEMNWMDVPSDKLFEPPVTMRDMLKSLSRTKPTVNEDDLKKLRK 433

  Fly   749 WSQDYG 754
            :::|:|
  Fly   434 FTEDFG 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 36/55 (65%)
AAA 515..652 CDD:214640 78/137 (57%)
AAA 519..650 CDD:278434 74/131 (56%)
Vps4_C <722..754 CDD:286426 9/31 (29%)
Vps4NP_001285396.1 MIT_VPS4 6..69 CDD:239141
RecA-like_VPS4 126..296 CDD:410929 98/171 (57%)
AAA_lid_3 323..361 CDD:407720 14/37 (38%)
Vps4_C 379..439 CDD:401324 12/59 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D59575at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23074
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.