DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and Trip13

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001011930.1 Gene:Trip13 / 292206 RGDID:1308516 Length:432 Species:Rattus norvegicus


Alignment Length:317 Identity:69/317 - (21%)
Similarity:119/317 - (37%) Gaps:90/317 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 INNNGPSGSGASTPVVSVKGVEQKLVQLILDEIVEG----------GAKVE--WTDIAGQDVAKQ 493
            :|..|||...                   |||..|.          .|:..  |..:......|.
  Rat   102 LNEEGPSSEN-------------------LDEETENIIAASHWVLPAAEFHGLWDSLVYDVEVKS 147

  Fly   494 ALQEMVIL------PSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECS---------AT 543
            .|.:.|:.      .:|...|.|..|.    :||.||||.|||.|.:|:|.:.:         ..
  Rat   148 HLLDYVMTTLLFSDKNVDSNLITWNRV----VLLHGPPGTGKTSLCKALAQKLTIRLSSRYRYGQ 208

  Fly   544 FLNISAASLTSKYVGDGEKLVRALFAVARHM---QPSIIF--IDEVDSLLSERSS----SEHEAS 599
            .:.|::.||.||:..:..|||..:|...:.:   :.:::|  ||||:||.:.|::    :|...:
  Rat   209 LIEINSHSLFSKWFSESGKLVTKMFQKIQDLIDDKEALVFVLIDEVESLTAARNACRAGAEPSDA 273

  Fly   600 RRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQT--------- 655
            .|:....|.:.|.:..:   ..:|:|..:|..:::|.|.:.|...:.|:..|....         
  Rat   274 IRVVNAVLTQIDQIKRH---SNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCL 335

  Fly   656 ------------------RELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTAL 694
                              |||.:...::...|.|.. .|..:::.::|.||..|..|
  Rat   336 EELMKCQIIYPRQQLLTLRELEMIGFIENNVSKLSL-LLSEISRKSEGLSGRVLRKL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 19/61 (31%)
AAA 515..652 CDD:214640 40/154 (26%)
AAA 519..650 CDD:278434 40/148 (27%)
Vps4_C <722..754 CDD:286426
Trip13NP_001011930.1 RecA-like_Pch2-like 121..319 CDD:410916 48/204 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.