DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and CG31495

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001287320.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster


Alignment Length:200 Identity:53/200 - (26%)
Similarity:87/200 - (43%) Gaps:30/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   520 LLFGPPGNGKTLLARAVATECSATFLN-ISAASLTSKYVGDGEKL--VRALFAVARHMQPSIIFI 581
            |:.|.|.:|.|.:|..:|.:....|:. ||:|.|..  :.|.||.  :|.:...|...:.|.:.|
  Fly   129 LVEGKPKSGLTTVAAQMALKTDCPFIKYISSAELLG--LSDSEKCQRIREVLEDAYVSRRSCVII 191

  Fly   582 DEVDSLLSERSSSEHEASRRLKTEFLVEFDGL----PGNPDGDRIVVLAATNRPQELDEAALRRF 642
            |:.     ||........:|...|||.:...|    |  |:...::::..:||...|:|..|...
  Fly   192 DDF-----ERVIGYGALGKRYSKEFLQKLTVLLKKQP--PNSHELIIICTSNRLDVLEELGLLSV 249

  Fly   643 TKRVYVSLPDEQT-RELLLNRLLQKQGSPLDTEALRRLAKITDGYSGS-------DLTALAKDAA 699
            ...|: ::|:..| :||::.....|:..|   |.||::....||.:.|       ||.|...  :
  Fly   250 FTSVH-NVPNVSTPKELMVIVEASKRFEP---EELRQIEIAMDGRNVSIGIKRLLDLIAWVN--S 308

  Fly   700 LEPIR 704
            |.|.|
  Fly   309 LNPDR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 6/17 (35%)
AAA 515..652 CDD:214640 35/138 (25%)
AAA 519..650 CDD:278434 35/136 (26%)
Vps4_C <722..754 CDD:286426
CG31495NP_001287320.1 AAA 129..259 CDD:214640 36/139 (26%)
P-loop_NTPase 129..257 CDD:304359 35/137 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.