Sequence 1: | NP_651206.3 | Gene: | spas / 42846 | FlyBaseID: | FBgn0039141 | Length: | 758 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287320.1 | Gene: | CG31495 / 261626 | FlyBaseID: | FBgn0051495 | Length: | 341 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 53/200 - (26%) |
---|---|---|---|
Similarity: | 87/200 - (43%) | Gaps: | 30/200 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 520 LLFGPPGNGKTLLARAVATECSATFLN-ISAASLTSKYVGDGEKL--VRALFAVARHMQPSIIFI 581
Fly 582 DEVDSLLSERSSSEHEASRRLKTEFLVEFDGL----PGNPDGDRIVVLAATNRPQELDEAALRRF 642
Fly 643 TKRVYVSLPDEQT-RELLLNRLLQKQGSPLDTEALRRLAKITDGYSGS-------DLTALAKDAA 699
Fly 700 LEPIR 704 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
spas | NP_651206.3 | MIT_spastin | 230..308 | CDD:239142 | |
P-loop_NTPase | 482..>538 | CDD:304359 | 6/17 (35%) | ||
AAA | 515..652 | CDD:214640 | 35/138 (25%) | ||
AAA | 519..650 | CDD:278434 | 35/136 (26%) | ||
Vps4_C | <722..754 | CDD:286426 | |||
CG31495 | NP_001287320.1 | AAA | 129..259 | CDD:214640 | 36/139 (26%) |
P-loop_NTPase | 129..257 | CDD:304359 | 35/137 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0464 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |