DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and pex6

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_593468.1 Gene:pex6 / 2542437 PomBaseID:SPAC17A5.01 Length:948 Species:Schizosaccharomyces pombe


Alignment Length:337 Identity:119/337 - (35%)
Similarity:180/337 - (53%) Gaps:33/337 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 RTPINNNGPSGSGASTPVVSVKGVEQKLVQLILDE--IVEGGAKVEWTDIAGQDVAKQALQEMVI 500
            ||..:|:....||   |:::.:.|:..:.::..::  .:....||.|.||.|.:.||..|::.:.
pombe   611 RTGYDNDSIILSG---PIITEQDVDVSINRIRKEKSNTIFTVPKVNWDDIGGLEEAKTVLRDTLQ 672

  Fly   501 LPSVRPELFT-GLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLV 564
            ||...||||: ||: |..|:||:||||.||||||:|||||.|..|::|....|.:.|||:.|..|
pombe   673 LPLQFPELFSQGLK-PRSGVLLYGPPGTGKTLLAKAVATELSLEFVSIKGPELLNMYVGESEANV 736

  Fly   565 RALFAVARHMQPSIIFIDEVDSLLSER--SSSEHEASRRLKTEFLVEFDGLPGNPDGDRIV-VLA 626
            |.:|..||:..|.:||.||:||:...|  ||.......|:.::.|.|.|.:  :.|.::.| |:.
pombe   737 RNVFEKARNSSPCVIFFDELDSIAPHRGNSSDSGNVMDRVVSQLLAELDSI--SKDNNKYVFVIG 799

  Fly   627 ATNRPQELDEAALR--RFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAK-ITDGYSG 688
            |||||..||.:.||  ||.|.||:.:...:..:..:.|.|.|.....:|..|..:|| ....::|
pombe   800 ATNRPDLLDPSLLRPGRFDKLVYLGINKSEESKASMLRALTKTFKLDETIDLNEIAKNCHPNFTG 864

  Fly   689 SDLTALAKDAALEPIRELNVE-----QVKCLDISAMR-------------AITEQDFHSSLKRIR 735
            :|:.||..||.|..|:....|     |....|:|...             .||::||.:|||::|
pombe   865 ADMYALCSDAVLSAIKRKTNEIDLLIQASGTDLSTEEFFKRNENQDSLELRITKEDFLTSLKKLR 929

  Fly   736 RSVAPQSLNSYE 747
            .|::.|.|:.||
pombe   930 PSISEQELHRYE 941

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 31/56 (55%)
AAA 515..652 CDD:214640 63/141 (45%)
AAA 519..650 CDD:278434 61/135 (45%)
Vps4_C <722..754 CDD:286426 13/26 (50%)
pex6NP_593468.1 SpoVK 426..937 CDD:223540 116/331 (35%)
AAA 426..544 CDD:278434
P-loop_NTPase 646..>719 CDD:304359 38/73 (52%)
AAA 691..824 CDD:278434 61/134 (46%)
Vps4_C <912..941 CDD:286426 11/28 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.