DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and sec18

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_594690.1 Gene:sec18 / 2542410 PomBaseID:SPAC1834.11c Length:792 Species:Schizosaccharomyces pombe


Alignment Length:469 Identity:123/469 - (26%)
Similarity:192/469 - (40%) Gaps:126/469 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 QSKPQKTREPM----LAGMTNEPMKLRVRSSG---------YGPKATTSAQPTASGRKLTIGSKR 382
            |::.:.|.||.    :|.:.....:.:|.|.|         |..|||..   |.|...|.||.  
pombe   154 QNRNRTTNEPFDGEEMAKLFCSSYQSQVFSPGQKIVFDFRSYNIKATVR---TISCVDLLIGE-- 213

  Fly   383 PVNLAVANKSQTLPRN-LGSKTSVGAVQRQPAKTAATPPAVRRQFSSGRNTPPQRSRTPINNNGP 446
              |....|.:.|..|. |.|:|.:     |..|.|.:  |:|.:.|..|         |.:|   
pombe   214 --NQDAENTADTSKRGLLTSQTEI-----QFFKAAHS--ALRLKASMTR---------PASN--- 257

  Fly   447 SGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQD-----VAKQALQEMVILPSVRP 506
                                     .|::.|.|.|...|.|.|     :.::|....:..|.:..
pombe   258 -------------------------AILQPGFKFEDMGIGGLDSEFSAIFRRAFASRLFPPGMVE 297

  Fly   507 ELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNI-SAASLTSKYVGDGEKLVRALFAV 570
            :|  |:. ..||:||:||||.||||:||.:....:|....| :...:.:||||..|:.||.|||.
pombe   298 KL--GIN-HVKGILLYGPPGTGKTLIARQIGKMLNAREPKIVNGPEILNKYVGQSEENVRKLFAD 359

  Fly   571 ARHMQPS--------IIFIDEVDSLLSERSSS--EHEASRRLKTEFLVEFDGLPGNPDGDRIVVL 625
            |......        ||..||:|::..:|.||  :.....::..:.|.:.||:   ...:.|:|:
pombe   360 AEREYRDRGEESGLHIIIFDELDAICKKRGSSGGDTGVGDQVVNQLLAKMDGV---DQLNNILVI 421

  Fly   626 AATNRPQELDEAALR--RFTKRVYVSLPDEQTRELLL---------NRLLQKQGSPLDTEALRRL 679
            ..|||...:|||.||  |....:.:|||||..|..:|         |.:|:   :.:|.|   .|
pombe   422 GMTNRKDMIDEALLRPGRLEVHMEISLPDEHGRLQILKIHTSRMASNGILE---NDVDME---EL 480

  Fly   680 AKITDGYSGSDLTALAKDA-ALEPIREL----------NVEQVKCLDISAMRAITEQDFHSSLKR 733
            |.:|..:||:::..|.|.| :....|.:          |:|.:|         :...||.::|..
pombe   481 ASLTKNFSGAEIAGLIKSASSFAFYRHIKVGTTAAVSGNLENIK---------VNRNDFLNALSE 536

  Fly   734 IRRS--VAPQSLNS 745
            :|.:  |:.:.|.|
pombe   537 VRPAYGVSEEELES 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 21/60 (35%)
AAA 515..652 CDD:214640 51/149 (34%)
AAA 519..650 CDD:278434 47/143 (33%)
Vps4_C <722..754 CDD:286426 7/26 (27%)
sec18NP_594690.1 CDC48_N 61..133 CDD:215012
CDC48_2 163..235 CDD:215011 21/78 (27%)
SpoVK 290..791 CDD:223540 82/282 (29%)
AAA 307..448 CDD:278434 47/143 (33%)
AAA 581..717 CDD:99707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.