DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and yta12

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_596797.1 Gene:yta12 / 2541079 PomBaseID:SPBC543.09 Length:773 Species:Schizosaccharomyces pombe


Alignment Length:335 Identity:106/335 - (31%)
Similarity:167/335 - (49%) Gaps:45/335 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 NGPSGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPEL 508
            :|.:|.|..    .:.|:.:...::...|.   ..|:::.|:||.|.||:.:.|.|.... .|:.
pombe   264 SGAAGGGQG----GIFGIGKSRAKMFNHET---DIKIKFADVAGVDEAKEEIMEFVKFLK-NPKF 320

  Fly   509 F--TGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVA 571
            :  .|.:.| :|.:|.||||.||||||:|.|.|.:..||::|.:.....:||.|...||.|||.|
pombe   321 YERLGAKIP-RGAILSGPPGTGKTLLAKATAGEANVPFLSVSGSEFLEMFVGVGPSRVRDLFATA 384

  Fly   572 RHMQPSIIFIDEVDSLLSER-------SSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATN 629
            |...|.||||||:|::...|       |:.|.|::   ..:.|||.||...:   :.|||.|.||
pombe   385 RKNAPCIIFIDEIDAIGKARGRGGQFGSNDEREST---LNQLLVEMDGFTSS---EHIVVFAGTN 443

  Fly   630 RPQELDEAALR--RFTKRVYVSLPDEQTRELLLNRLLQ--KQGSPLDTEALRRLAKITDGYSGSD 690
            ||..||.|.||  ||.:::.:..||...||.:....|:  |....:|..| :|||.:|.|::|:|
pombe   444 RPDVLDPALLRPGRFDRQITIDRPDIGGREQIFKVHLKHIKAADNIDLIA-KRLAVLTSGFTGAD 507

  Fly   691 LTALAKDAALEPIRELNVEQVKCLDI-SAMRAITEQDFHSSLKRIRRSVAPQSLNSYEK------ 748
            :..:..:.||...|. |..:|:.:.. .|:..:|     :.|::..|.::|:..|:...      
pombe   508 IMNVCNEGALIAARS-NSNEVQMVHFEQAIERVT-----AGLEKKSRVLSPEEKNTVAHHEAGHA 566

  Fly   749 ---WSQDYGD 755
               |..:|.|
pombe   567 VAGWFMEYVD 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 24/57 (42%)
AAA 515..652 CDD:214640 61/145 (42%)
AAA 519..650 CDD:278434 59/139 (42%)
Vps4_C <722..754 CDD:286426 6/40 (15%)
yta12NP_596797.1 FtsH_ext 136..230 CDD:284011
FtsH_fam 238..733 CDD:273520 106/335 (32%)
AAA 333..466 CDD:278434 59/138 (43%)
Peptidase_M41 548..731 CDD:279742 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.