DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and cdc-48.3

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_492211.1 Gene:cdc-48.3 / 172586 WormBaseID:WBGene00010562 Length:724 Species:Caenorhabditis elegans


Alignment Length:251 Identity:99/251 - (39%)
Similarity:143/251 - (56%) Gaps:18/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 GVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFT--GLRAPAKGLLLF 522
            |:.|.::::         ..|.|.||.|.:..|..:|:.||.|...||.|.  |:..|| |:||:
 Worm   445 GIRQFILEV---------PNVSWNDIGGNEELKLEIQQAVIWPQKHPEAFERFGIDPPA-GILLY 499

  Fly   523 GPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSL 587
            ||||..|||:|||:|:|....||.:....|.||:|||.||.:|.||:.||.:.|:|:|.||:|::
 Worm   500 GPPGCSKTLIARALASEAKMNFLAVKGPELFSKWVGDSEKAIRDLFSRARQVAPTIVFFDEIDAV 564

  Fly   588 LSERSSSEHE-ASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALR--RFTKRVYVS 649
            .|.|.|.:.. .|.|:..:.|.|.|||   ....|:::|||||||.:||.|.||  |..:.:||.
 Worm   565 GSSRGSEKSSGVSDRVLAQLLTELDGL---EKSSRVILLAATNRPDQLDSALLRPGRLDRAIYVG 626

  Fly   650 LPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRE 705
            ||.|.||..:|....:|.........:.:|.:.|.||||::|.|:.:.||:..:||
 Worm   627 LPCEVTRRAILEMRTKKMKFDDTVRTIDKLVEKTSGYSGAELVAVCRTAAMFAMRE 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 28/57 (49%)
AAA 515..652 CDD:214640 65/139 (47%)
AAA 519..650 CDD:278434 61/133 (46%)
Vps4_C <722..754 CDD:286426
cdc-48.3NP_492211.1 TIP49 <247..720 CDD:332389 99/251 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.