DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and AgaP_AGAP007770

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_317745.1 Gene:AgaP_AGAP007770 / 1278195 VectorBaseID:AGAP007770 Length:228 Species:Anopheles gambiae


Alignment Length:89 Identity:23/89 - (25%)
Similarity:42/89 - (47%) Gaps:13/89 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 GDGEKL---VRALFAVARHMQP--SIIFIDEVDSLLSERS--SSEHEASRRLKTEFLVEFDGLPG 615
            |:.|::   :|.|...:.|..|  ::..:..::.||...|  ..:...|.:|.:|.|.::..|..
Mosquito     6 GNVEEIFLCLRRLKETSSHKDPNQAVNDVRNLNYLLHTESLQIDDERLSAQLLSEGLHKYQDLMT 70

  Fly   616 NPDG-----DRIVVLAATNRPQEL 634
            ||||     |.::.|..| :|.|:
Mosquito    71 NPDGVNNYCDDVLELLNT-QPSEM 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359
AAA 515..652 CDD:214640 23/89 (26%)
AAA 519..650 CDD:278434 23/89 (26%)
Vps4_C <722..754 CDD:286426
AgaP_AGAP007770XP_317745.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001088
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.