DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and AgaP_AGAP012537

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_307605.4 Gene:AgaP_AGAP012537 / 1269024 VectorBaseID:AGAP012537 Length:175 Species:Anopheles gambiae


Alignment Length:141 Identity:35/141 - (24%)
Similarity:58/141 - (41%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   559 DGEKL--VRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDR 621
            :|.|.  :|..|..|.....|.|.:|.::.||.........::..|:. .||.....|  |.|.:
Mosquito     6 EGAKCLQIRKYFDDAYRSTFSCILVDNIERLLDYGPIGPRYSNLTLQA-LLVLLKKSP--PKGKK 67

  Fly   622 IVVLAATNRPQEL-DEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDG 685
            :::|..|:|.|.| |...|..||..::|  |:..|.:.|:..|.|:                .|.
Mosquito    68 LLILCTTSRRQVLEDMEMLSAFTAVLHV--PNLSTADHLIAVLEQE----------------PDV 114

  Fly   686 YSGSDLTALAK 696
            :..::|.|:.|
Mosquito   115 FGRNELAAIYK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359
AAA 515..652 CDD:214640 26/95 (27%)
AAA 519..650 CDD:278434 26/93 (28%)
Vps4_C <722..754 CDD:286426
AgaP_AGAP012537XP_307605.4 AAA <3..97 CDD:214640 26/95 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.