DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and YME1L1

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_647473.1 Gene:YME1L1 / 10730 HGNCID:12843 Length:773 Species:Homo sapiens


Alignment Length:279 Identity:100/279 - (35%)
Similarity:142/279 - (50%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 VEWTDIAGQDVAKQALQEMVILPSVRPELFT--GLRAPAKGLLLFGPPGNGKTLLARAVATECSA 542
            |.:..:.|.:.|||.|||:|.... .|:.||  |.:.| ||:||.||||.||||||||||.|...
Human   336 VTFEHVKGVEEAKQELQEVVEFLK-NPQKFTILGGKLP-KGILLVGPPGTGKTLLARAVAGEADV 398

  Fly   543 TFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSER-SSSEHEASRRLKTEF 606
            .|...|.:.....:||.|...:|.||..|:...|.:|||||:||:..:| .|..|..||:...:.
Human   399 PFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQL 463

  Fly   607 LVEFDGLPGNPDGDRIVVLAATNRPQELDEAALR--RFTKRVYVSLPDEQTR-ELL---LNRLLQ 665
            |.|.||...|   :.::::.|||.|:.||.|.:|  ||..:|.|..||.:.| |:|   ||::  
Human   464 LAEMDGFKPN---EGVIIIGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKI-- 523

  Fly   666 KQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITEQDFHSS 730
            |....:|.|.   :|:.|.|:||::|..|...|||:..            :.....:|.::...|
Human   524 KFDQSVDPEI---IARGTVGFSGAELENLVNQAALKAA------------VDGKEMVTMKELEFS 573

  Fly   731 LKRI-----RRSVAPQSLN 744
            ..:|     ||||...:.|
Human   574 KDKILMGPERRSVEIDNKN 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 30/57 (53%)
AAA 515..652 CDD:214640 59/139 (42%)
AAA 519..650 CDD:278434 56/133 (42%)
Vps4_C <722..754 CDD:286426 8/28 (29%)
YME1L1NP_647473.1 P-loop_NTPase 331..>395 CDD:304359 32/60 (53%)
FtsH_fam 333..766 CDD:273520 100/279 (36%)
AAA 375..506 CDD:278434 56/133 (42%)
Peptidase_M41 586..764 CDD:279742 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.