DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and spg7

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:XP_002933705.2 Gene:spg7 / 100485977 XenbaseID:XB-GENE-6034036 Length:768 Species:Xenopus tropicalis


Alignment Length:285 Identity:99/285 - (34%)
Similarity:149/285 - (52%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 IVEG--GAKVEWTDIAGQDVAKQALQEMV-ILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLAR 534
            ||:|  |..:.:.|:||...||..::|.| .|.|....|..|.:.| ||.||.||||.||||||:
 Frog   270 IVDGKSGKGISFKDVAGMHEAKLEVKEFVDYLKSPDRYLQLGAKVP-KGALLLGPPGCGKTLLAK 333

  Fly   535 AVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSS-----S 594
            |||||....||.::.:.......|.|...||:||..||...|.|::|||:|::..:||:     |
 Frog   334 AVATEAQVPFLAMAGSEFVEVIGGLGAARVRSLFKEARTRAPCIVYIDEIDAVGKKRSTNMSSFS 398

  Fly   595 EHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALR--RFTKRVYVSLPD-EQTR 656
            ..|..:.| .:.|||.||:...   |.::|||:|||...||.|.:|  |..:.:::.||. ::.|
 Frog   399 NTEEEQTL-NQLLVEMDGMGTT---DHVIVLASTNRADILDNALMRPGRLDRHIFIDLPTLQERR 459

  Fly   657 ELLLNRL----LQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDIS 717
            |:....|    |.:.||...    :|||::|.|:||:|:..:..:|||...||            
 Frog   460 EIFEQHLKSLKLTQPGSFYS----QRLAELTPGFSGADIANICNEAALHAARE------------ 508

  Fly   718 AMRAITEQDFHSSLKRIRRSVAPQS 742
            ..::|...:|..:::|:....|.:|
 Frog   509 GYQSIDTFNFEYAVERVIAGTAKKS 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 28/56 (50%)
AAA 515..652 CDD:214640 59/143 (41%)
AAA 519..650 CDD:278434 55/137 (40%)
Vps4_C <722..754 CDD:286426 5/21 (24%)
spg7XP_002933705.2 FtsH_ext 118..215 CDD:377663
FtsH_fam 239..720 CDD:273520 99/285 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.