DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and prxl2a

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_001090691.1 Gene:prxl2a / 100036669 XenbaseID:XB-GENE-962667 Length:227 Species:Xenopus tropicalis


Alignment Length:75 Identity:17/75 - (22%)
Similarity:29/75 - (38%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GASTKVIYRPHRRDCNIEIVVQNSSKEQQQSLNHPSELNREGDGQEQQLSNQPQRFRPIQPLEMA 209
            ||....:.||....|..|....:|.|.|...|..|...     ..::.:.|:.::|:|....::.
 Frog    73 GAVVMAVRRPGCFLCREEASDLSSLKSQLDQLGVPLYA-----VVKENIGNEVEQFQPYFNGKIF 132

  Fly   210 ANRPGGGYSP 219
            .:..|..|.|
 Frog   133 LDEKGKFYGP 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359
AAA 515..652 CDD:214640
AAA 519..650 CDD:278434
Vps4_C <722..754 CDD:286426
prxl2aNP_001090691.1 Thioredoxin fold. /evidence=ECO:0000250 13..111 11/42 (26%)
PRX_like2 47..200 CDD:239268 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.