powered by:
Protein Alignment spas and prxl2a
DIOPT Version :9
Sequence 1: | NP_651206.3 |
Gene: | spas / 42846 |
FlyBaseID: | FBgn0039141 |
Length: | 758 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001090691.1 |
Gene: | prxl2a / 100036669 |
XenbaseID: | XB-GENE-962667 |
Length: | 227 |
Species: | Xenopus tropicalis |
Alignment Length: | 75 |
Identity: | 17/75 - (22%) |
Similarity: | 29/75 - (38%) |
Gaps: | 5/75 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 145 GASTKVIYRPHRRDCNIEIVVQNSSKEQQQSLNHPSELNREGDGQEQQLSNQPQRFRPIQPLEMA 209
||....:.||....|..|....:|.|.|...|..|... ..::.:.|:.::|:|....::.
Frog 73 GAVVMAVRRPGCFLCREEASDLSSLKSQLDQLGVPLYA-----VVKENIGNEVEQFQPYFNGKIF 132
Fly 210 ANRPGGGYSP 219
.:..|..|.|
Frog 133 LDEKGKFYGP 142
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0464 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.