DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Miro and RHO4

DIOPT Version :9

Sequence 1:NP_001262895.1 Gene:Miro / 42845 FlyBaseID:FBgn0039140 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_012981.3 Gene:RHO4 / 853929 SGDID:S000001763 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:63/244 - (25%)
Similarity:98/244 - (40%) Gaps:50/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YTASQRKN------VRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEE--ITIPANVTPEQVPT 60
            |...:|.|      ::|::|||..||||.|::|.|...:|.:..|...|  :|.......:.:..
Yeast    59 YEQMKRTNKLPDYHLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIEL 123

  Fly    61 SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAE 125
            ::.|.:..|:...........|.|:.:.|:|....:|..:...|.|.|:..| ||          
Yeast   124 ALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFC-PS---------- 177

  Fly   126 AEGDTQREPIRKPIVLVG---------NKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHNI 181
                       .||:|||         |..||:|.|:.:|:...:..:..|    :|||:...||
Yeast   178 -----------TPIMLVGLKSDLYEADNLSDLVEPSSAESLAKRLGAFAHI----QCSARLKENI 227

  Fly   182 SEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDID---GD 227
            .|:|..|...:|  :..||  ..:|.|...|....|.....|||   ||
Yeast   228 DEVFETAIHTLL--SDSLY--APREPTHTIKNPFKRNTTRSDIDSSTGD 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MiroNP_001262895.1 Miro1 10..195 CDD:206680 50/201 (25%)
RHO 14..195 CDD:197554 49/191 (26%)
EF_assoc_2 247..328 CDD:285547
EF_assoc_1 367..437 CDD:285546
Miro2 444..620 CDD:206679
Ras 448..602 CDD:278499
RHO4NP_012981.3 Rho4_like 70..248 CDD:206704 51/207 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1464
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.