DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Miro and Rac2

DIOPT Version :9

Sequence 1:NP_001262895.1 Gene:Miro / 42845 FlyBaseID:FBgn0039140 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001261517.1 Gene:Rac2 / 38831 FlyBaseID:FBgn0014011 Length:192 Species:Drosophila melanogaster


Alignment Length:200 Identity:47/200 - (23%)
Similarity:88/200 - (44%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPTS--IVDFSAVEQSEDA 74
            ::.::|||..||||.|::|..:..:|.|..|...: ...|||..:..|.:  :.|.:..|..:..
  Fly     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFD-NYSANVMVDAKPINLGLWDTAGQEDYDRL 67

  Fly    75 LAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAEAEGDTQREPIRKPI 139
            ......:..|..|.:::.:..:.:.:.:.|.|.||..| ||:                     ||
  Fly    68 RPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHC-PSV---------------------PI 110

  Fly   140 VLVGNKIDL-IEYSTMDSV-------------LAIMEDYPEIESCVECSAKSLHNISEMFYYAQK 190
            :|||.|:|| .:..|::.:             ||:.::...:: .:||||.:...:..:|..|.:
  Fly   111 ILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVK-YLECSALTQKGLKTVFDEAIR 174

  Fly   191 AVLHP 195
            :||.|
  Fly   175 SVLCP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MiroNP_001262895.1 Miro1 10..195 CDD:206680 46/198 (23%)
RHO 14..195 CDD:197554 46/196 (23%)
EF_assoc_2 247..328 CDD:285547
EF_assoc_1 367..437 CDD:285546
Miro2 444..620 CDD:206679
Ras 448..602 CDD:278499
Rac2NP_001261517.1 Rac1_like 3..176 CDD:206663 44/195 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.