DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Miro and Rho1

DIOPT Version :9

Sequence 1:NP_001262895.1 Gene:Miro / 42845 FlyBaseID:FBgn0039140 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_477098.1 Gene:Rho1 / 36775 FlyBaseID:FBgn0014020 Length:192 Species:Drosophila melanogaster


Alignment Length:195 Identity:51/195 - (26%)
Similarity:82/195 - (42%) Gaps:36/195 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RILLVGDAGVGKTSLILSLVSEEYPE-EVPPRAEEITIPANVTPEQVPTSIVDFSAVEQSEDALA 76
            ::::|||...|||.|::....:::|| .||...|.......|..:||..::.|.:..|..:....
  Fly     7 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71

  Fly    77 AEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAEAEGDTQREPIRKPIVL 141
            .......|:.:.::||..|:|:.|...|.|.|:..| |::                     ||:|
  Fly    72 LSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFC-PNV---------------------PIIL 114

  Fly   142 VGNKIDLIEYSTMDSVLAIMEDYP-------------EIESCVECSAKSLHNISEMFYYAQKAVL 193
            ||||.||.........||.|:..|             ...:.:||||||...:.::|..|.:|.|
  Fly   115 VGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAAL 179

  Fly   194  193
              Fly   180  179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MiroNP_001262895.1 Miro1 10..195 CDD:206680 51/195 (26%)
RHO 14..195 CDD:197554 51/194 (26%)
EF_assoc_2 247..328 CDD:285547
EF_assoc_1 367..437 CDD:285546
Miro2 444..620 CDD:206679
Ras 448..602 CDD:278499
Rho1NP_477098.1 RhoA_like 5..179 CDD:206662 50/193 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.