DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Miro and Cdc42

DIOPT Version :9

Sequence 1:NP_001262895.1 Gene:Miro / 42845 FlyBaseID:FBgn0039140 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001245762.1 Gene:Cdc42 / 32981 FlyBaseID:FBgn0010341 Length:191 Species:Drosophila melanogaster


Alignment Length:204 Identity:46/204 - (22%)
Similarity:83/204 - (40%) Gaps:38/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KNVRILLVGDAGVGKTSLILSLVSEEYPEE-VPPRAEEITIPANVTPEQVPTSIVDFSAVEQSED 73
            :.::.::|||..||||.|::|..:.::|.| ||...:...:...:..|.....:.|.:..|..:.
  Fly     2 QTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDR 66

  Fly    74 ALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAEAEGDTQREPIRKP 138
            .......:..|..:.::|....:.:.:...|:|.:...|.                      :.|
  Fly    67 LRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQ----------------------KTP 109

  Fly   139 IVLVGNKIDL-IEYSTMDSVLAIMEDYP-----------EIESC--VECSAKSLHNISEMFYYAQ 189
            .:|||.:||| .|.||::. ||..:..|           |:::.  |||||.:...:..:|..|.
  Fly   110 FLLVGTQIDLRDENSTLEK-LAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAI 173

  Fly   190 KAVLHPTSP 198
            .|.|.|..|
  Fly   174 LAALEPPEP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MiroNP_001262895.1 Miro1 10..195 CDD:206680 44/199 (22%)
RHO 14..195 CDD:197554 44/195 (23%)
EF_assoc_2 247..328 CDD:285547
EF_assoc_1 367..437 CDD:285546
Miro2 444..620 CDD:206679
Ras 448..602 CDD:278499
Cdc42NP_001245762.1 Cdc42 3..177 CDD:206664 43/196 (22%)
RHO 6..179 CDD:197554 44/195 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.