Sequence 1: | NP_001262895.1 | Gene: | Miro / 42845 | FlyBaseID: | FBgn0039140 | Length: | 673 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245762.1 | Gene: | Cdc42 / 32981 | FlyBaseID: | FBgn0010341 | Length: | 191 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 46/204 - (22%) |
---|---|---|---|
Similarity: | 83/204 - (40%) | Gaps: | 38/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KNVRILLVGDAGVGKTSLILSLVSEEYPEE-VPPRAEEITIPANVTPEQVPTSIVDFSAVEQSED 73
Fly 74 ALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAEAEGDTQREPIRKP 138
Fly 139 IVLVGNKIDL-IEYSTMDSVLAIMEDYP-----------EIESC--VECSAKSLHNISEMFYYAQ 189
Fly 190 KAVLHPTSP 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Miro | NP_001262895.1 | Miro1 | 10..195 | CDD:206680 | 44/199 (22%) |
RHO | 14..195 | CDD:197554 | 44/195 (23%) | ||
EF_assoc_2 | 247..328 | CDD:285547 | |||
EF_assoc_1 | 367..437 | CDD:285546 | |||
Miro2 | 444..620 | CDD:206679 | |||
Ras | 448..602 | CDD:278499 | |||
Cdc42 | NP_001245762.1 | Cdc42 | 3..177 | CDD:206664 | 43/196 (22%) |
RHO | 6..179 | CDD:197554 | 44/195 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45466326 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24072 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |