DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Miro and RhoU

DIOPT Version :9

Sequence 1:NP_001262895.1 Gene:Miro / 42845 FlyBaseID:FBgn0039140 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster


Alignment Length:199 Identity:50/199 - (25%)
Similarity:83/199 - (41%) Gaps:25/199 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASQRKNVRILLVGDAGVGKTSLILSLVSEEY-PEEVPPRAEEITIPANVTPEQVPTSIVDFSAVE 69
            |..:.:::.:||||..||||:||||.:...: ||.:|..::......||....|..:|.|.:..:
  Fly   387 AQPQPSIKCVLVGDGAVGKTNLILSYLENRFNPEHIPTASDIYNADVNVNESPVHLTICDTAGQD 451

  Fly    70 QSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAEAEGDTQREP 134
            ..:.........:.|..:.::|...:|...|.:.|.|.. ||...:|...|         ||.:.
  Fly   452 TLDPLRELCYPDSDVFLLCFSVVKPETFRAIKTKWAPKF-AKTKAALILVG---------TQADL 506

  Fly   135 IRKPIVLVGNKI-----DLIEYS-TMDSVLAIMEDYPEIESCVECSAKSLHNISEMFYYAQKAVL 193
            ...|.||  ||:     :.|.|: ..|....|...|      :|.|:.:...:.::|..|....|
  Fly   507 RTSPNVL--NKLQTNGEEAISYADAWDLATTIGAKY------IETSSATQDKVKDVFDTAIWEGL 563

  Fly   194 HPTS 197
            .||:
  Fly   564 VPTT 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MiroNP_001262895.1 Miro1 10..195 CDD:206680 47/191 (25%)
RHO 14..195 CDD:197554 47/187 (25%)
EF_assoc_2 247..328 CDD:285547
EF_assoc_1 367..437 CDD:285546
Miro2 444..620 CDD:206679
Ras 448..602 CDD:278499
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 46/186 (25%)
RHO 395..559 CDD:197554 45/181 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.