Sequence 1: | NP_001262895.1 | Gene: | Miro / 42845 | FlyBaseID: | FBgn0039140 | Length: | 673 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001036266.1 | Gene: | RhoU / 31945 | FlyBaseID: | FBgn0083940 | Length: | 582 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 50/199 - (25%) |
---|---|---|---|
Similarity: | 83/199 - (41%) | Gaps: | 25/199 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 ASQRKNVRILLVGDAGVGKTSLILSLVSEEY-PEEVPPRAEEITIPANVTPEQVPTSIVDFSAVE 69
Fly 70 QSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEGDAEAEAEGDTQREP 134
Fly 135 IRKPIVLVGNKI-----DLIEYS-TMDSVLAIMEDYPEIESCVECSAKSLHNISEMFYYAQKAVL 193
Fly 194 HPTS 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Miro | NP_001262895.1 | Miro1 | 10..195 | CDD:206680 | 47/191 (25%) |
RHO | 14..195 | CDD:197554 | 47/187 (25%) | ||
EF_assoc_2 | 247..328 | CDD:285547 | |||
EF_assoc_1 | 367..437 | CDD:285546 | |||
Miro2 | 444..620 | CDD:206679 | |||
Ras | 448..602 | CDD:278499 | |||
RhoU | NP_001036266.1 | Wrch_1 | 393..562 | CDD:133330 | 46/186 (25%) |
RHO | 395..559 | CDD:197554 | 45/181 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24072 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |