DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm3 and LSM3A

DIOPT Version :9

Sequence 1:NP_001163707.1 Gene:LSm3 / 42842 FlyBaseID:FBgn0051184 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_173542.1 Gene:LSM3A / 838714 AraportID:AT1G21190 Length:97 Species:Arabidopsis thaliana


Alignment Length:87 Identity:65/87 - (74%)
Similarity:82/87 - (94%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQHLNMVLGDAEETVTTVEIDEETYEEVYKTA 79
            |:|||||||||::|::|||:|::|||||:||||||||||:|||.||.:||:|||:|||||:.:|.
plant     9 VREPLDLIRLSIEERIYVKLRSDRELRGKLHAFDQHLNMILGDVEEVITTIEIDDETYEEIVRTT 73

  Fly    80 KRTIPMLFVRGDGVILVSPPMR 101
            |||:|.||||||||||||||:|
plant    74 KRTVPFLFVRGDGVILVSPPLR 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm3NP_001163707.1 LSm3 17..98 CDD:212477 60/80 (75%)
LSM3ANP_173542.1 LSm3 11..92 CDD:212477 60/80 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 133 1.000 Domainoid score I1646
eggNOG 1 0.900 - - E1_KOG3460
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6548
Inparanoid 1 1.050 150 1.000 Inparanoid score I1717
OMA 1 1.010 - - QHG54341
OrthoDB 1 1.010 - - D1633672at2759
OrthoFinder 1 1.000 - - FOG0004431
OrthoInspector 1 1.000 - - otm2560
orthoMCL 1 0.900 - - OOG6_101597
Panther 1 1.100 - - O PTHR13110
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3139
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.