DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm3 and Lsm3

DIOPT Version :9

Sequence 1:NP_001163707.1 Gene:LSm3 / 42842 FlyBaseID:FBgn0051184 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_080585.1 Gene:Lsm3 / 67678 MGIID:1914928 Length:102 Species:Mus musculus


Alignment Length:103 Identity:79/103 - (76%)
Similarity:93/103 - (90%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQHLNMVLGDAEETVTTV 65
            |||:.:| .|....|:||||||||||||::||||||:|||||||||:||||||:|||.||||||:
Mouse     1 MADDVDQ-QQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTI 64

  Fly    66 EIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPMRVG 103
            |||||||||:||:.||.|||||||||||:||:||:|||
Mouse    65 EIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm3NP_001163707.1 LSm3 17..98 CDD:212477 68/80 (85%)
Lsm3NP_080585.1 LSm3 16..97 CDD:212477 68/80 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845817
Domainoid 1 1.000 138 1.000 Domainoid score I4843
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6548
Inparanoid 1 1.050 167 1.000 Inparanoid score I4164
Isobase 1 0.950 - 0 Normalized mean entropy S375
OMA 1 1.010 - - QHG54341
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004431
OrthoInspector 1 1.000 - - oto94573
orthoMCL 1 0.900 - - OOG6_101597
Panther 1 1.100 - - O PTHR13110
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R667
SonicParanoid 1 1.000 - - X3139
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.