DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm3 and lsm-3

DIOPT Version :9

Sequence 1:NP_001163707.1 Gene:LSm3 / 42842 FlyBaseID:FBgn0051184 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_502579.1 Gene:lsm-3 / 178303 WormBaseID:WBGene00003077 Length:102 Species:Caenorhabditis elegans


Alignment Length:101 Identity:70/101 - (69%)
Similarity:87/101 - (86%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQHLNMVLGDAEETVTTV 65
            ||.|.:::: :...|:|||||:||||||:|||||||:|||||||.||||||||||.:.|||:||.
 Worm     1 MATEKKEVT-LSATVEEPLDLLRLSLDERVYVKMRNDRELRGRLRAFDQHLNMVLSEVEETITTR 64

  Fly    66 EIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPMR 101
            |:||:|:||:||..||.:||||||||.|||||||:|
 Worm    65 EVDEDTFEEIYKQTKRVVPMLFVRGDSVILVSPPIR 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm3NP_001163707.1 LSm3 17..98 CDD:212477 62/80 (78%)
lsm-3NP_502579.1 LSm3 16..97 CDD:212477 62/80 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164013
Domainoid 1 1.000 128 1.000 Domainoid score I3325
eggNOG 1 0.900 - - E1_KOG3460
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6548
Inparanoid 1 1.050 145 1.000 Inparanoid score I3029
Isobase 1 0.950 - 0 Normalized mean entropy S375
OMA 1 1.010 - - QHG54341
OrthoDB 1 1.010 - - D1633672at2759
OrthoFinder 1 1.000 - - FOG0004431
OrthoInspector 1 1.000 - - oto17651
orthoMCL 1 0.900 - - OOG6_101597
Panther 1 1.100 - - LDO PTHR13110
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R667
SonicParanoid 1 1.000 - - X3139
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1716.790

Return to query results.
Submit another query.