DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm3 and SmD2

DIOPT Version :10

Sequence 1:NP_732931.1 Gene:LSm3 / 42842 FlyBaseID:FBgn0051184 Length:103 Species:Drosophila melanogaster
Sequence 2:XP_318388.2 Gene:SmD2 / 1278762 VectorBaseID:AGAMI1_006158 Length:119 Species:Anopheles gambiae


Alignment Length:82 Identity:31/82 - (37%)
Similarity:49/82 - (59%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PLDLIRLSL--DEKVYVKMRNERELRGRLHAFDQHLNMVLGDAEETVTTVEIDEETYEEVYKTAK 80
            ||.::..|:  :.:|.:..||.::|.||:.|||:|.||||.:.:|..|.:....:..::|....|
Mosquito    27 PLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEIPRTGKGKKKVKPVNK 91

  Fly    81 -RTIPMLFVRGDGVILV 96
             |.|..:|:|||.||||
Mosquito    92 DRFISKMFLRGDSVILV 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm3NP_732931.1 LSm3 17..98 CDD:212477 31/82 (38%)
SmD2XP_318388.2 Sm_D2 23..112 CDD:212467 31/82 (38%)

Return to query results.
Submit another query.