DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm3 and lsm3

DIOPT Version :9

Sequence 1:NP_001163707.1 Gene:LSm3 / 42842 FlyBaseID:FBgn0051184 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001165758.1 Gene:lsm3 / 100125161 XenbaseID:XB-GENE-991265 Length:102 Species:Xenopus tropicalis


Alignment Length:103 Identity:80/103 - (77%)
Similarity:93/103 - (90%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQHLNMVLGDAEETVTTV 65
            |||:.|| .|....|:||||||||||||::||||||:|||||||||:||||||:|||.||||||:
 Frog     1 MADDGEQ-QQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTI 64

  Fly    66 EIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPMRVG 103
            |||||||||:||:.||.|||||||||||:||:||:|||
 Frog    65 EIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm3NP_001163707.1 LSm3 17..98 CDD:212477 68/80 (85%)
lsm3NP_001165758.1 LSm3 16..97 CDD:212477 68/80 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4822
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6548
Inparanoid 1 1.050 162 1.000 Inparanoid score I4116
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1633672at2759
OrthoFinder 1 1.000 - - FOG0004431
OrthoInspector 1 1.000 - - oto104776
Panther 1 1.100 - - LDO PTHR13110
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R667
SonicParanoid 1 1.000 - - X3139
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.