DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and YPT31

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_010948.1 Gene:YPT31 / 856753 SGDID:S000000833 Length:223 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:68/215 - (31%)
Similarity:119/215 - (55%) Gaps:22/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.|::::|||.|||::|::::....|:...|:|||.:|.|:.:.::.:.:..||||||||||:::
Yeast    13 LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRA 77

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136
            :..|:||||...::|||::..:|::|.:.|..|....|.    |:....::|||.||.: |.|.|
Yeast    78 ITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD----DNVAVGLIGNKSDLAHLRAVPT 138

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAF--------QVIAKNALELEAE--------AEVIND 185
            ..::.:.| :|.:.:.||||....||:.||        |.::|:.::|...        |...|.
Yeast   139 EESKTFAQ-ENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNG 202

  Fly   186 FPDQITLGSQNNRPGNPDNC 205
            ....:|.....|:..|.:||
Yeast   203 PTISLTPTPNENKKANGNNC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 60/178 (34%)
RAB 9..174 CDD:197555 59/173 (34%)
YPT31NP_010948.1 Rab11_like 11..175 CDD:206660 58/166 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.