DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and YPT7

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_013713.1 Gene:YPT7 / 855012 SGDID:S000004460 Length:208 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:127/214 - (59%)
Similarity:161/214 - (75%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVN-DRVVTMQIWDT 64
            ||.|||::|||||||||.|||||||::|||.::|.||||||||||.||||.|: |:|.|||:|||
Yeast     1 MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDT 65

  Fly    65 AGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129
            |||||||||||||||||||||||||||..:||:|:.|||||||:.|:...|:.||||:||||:|.
Yeast    66 AGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDA 130

  Fly   130 DNRQ--VSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALEL-EAEAEVI-NDFPD-- 188
            :..:  ||.:.||:..:|..|||.:.||||..|||:.||:.||::||:. :|:.|.. :|:.|  
Yeast   131 EESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQADTEAFEDDYNDAI 195

  Fly   189 QITLGSQNNRPGNPDNCQC 207
            .|.|..:||      :|.|
Yeast   196 NIRLDGENN------SCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 112/173 (65%)
RAB 9..174 CDD:197555 110/167 (66%)
YPT7NP_013713.1 Rab7 9..182 CDD:206655 112/172 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 223 1.000 Domainoid score I440
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I691
Isobase 1 0.950 - 0 Normalized mean entropy S534
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - oto99536
orthoMCL 1 0.900 - - OOG6_101358
Panther 1 1.100 - - LDO PTHR47981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2001
SonicParanoid 1 1.000 - - X1058
TreeFam 1 0.960 - -
1312.800

Return to query results.
Submit another query.