DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and GSP2

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_014828.1 Gene:GSP2 / 854357 SGDID:S000005711 Length:220 Species:Saccharomyces cerevisiae


Alignment Length:201 Identity:57/201 - (28%)
Similarity:102/201 - (50%) Gaps:26/201 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::::||...|||:.:.:::...|..:|.||||.:........|...:...:|||||||:|..|.
Yeast    15 KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLR 79

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRRA 139
            ..:|..|.|.::::|||:..::||:.:|..:.:     |..::.|.|:.|||||:..|:|..:..
Yeast    80 DGYYINAQCAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLCGNKVDVKERKVKAKTI 139

  Fly   140 QQWCQSKNDIPYYETSAKEGINVEMAF-------------QVIAKNAL---ELEAEAEVINDFP- 187
            .  ...|.::.||:.|||...|.|..|             :.:|..||   |::.:.::::.:. 
Yeast   140 T--FHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMHQYQQ 202

  Fly   188 --DQIT 191
              ||.|
Yeast   203 EMDQAT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 54/184 (29%)
RAB 9..174 CDD:197555 51/176 (29%)
GSP2NP_014828.1 PTZ00132 5..217 CDD:240284 57/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.