Sequence 1: | NP_001247276.1 | Gene: | Rab7 / 42841 | FlyBaseID: | FBgn0015795 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009823.2 | Gene: | YPT10 / 852567 | SGDID: | S000000468 | Length: | 199 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 206 | Identity: | 68/206 - (33%) |
---|---|---|---|
Similarity: | 108/206 - (52%) | Gaps: | 33/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTK--EVVVND----RVVTMQIWDT 64
Fly 65 AGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL 129
Fly 130 ----DNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQI 190
Fly 191 TLGSQNNRPGN 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab7 | NP_001247276.1 | Rab7 | 9..179 | CDD:206655 | 61/179 (34%) |
RAB | 9..174 | CDD:197555 | 60/174 (34%) | ||
YPT10 | NP_009823.2 | Rab | 5..158 | CDD:206640 | 58/167 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |