DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and SEC4

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_116650.1 Gene:SEC4 / 850543 SGDID:S000001889 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:73/204 - (35%)
Similarity:113/204 - (55%) Gaps:19/204 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRKK---SLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWD 63
            ||..|   |::|::::|||.|||:.|:.::|..:|:..:..|||.||..|.|.:|.:.|.:|:||
Yeast    11 SGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWD 75

  Fly    64 TAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVD 128
            |||||||:::..|:||||...:||||||...:|.|:..|.......|:    |....:::|||.|
Yeast    76 TAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN----DEAQLLLVGNKSD 136

  Fly   129 LDNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITL- 192
            ::.|.|:..:.:...:... ||:.|:|||...||...|..:||          :|.:..|...| 
Yeast   137 METRVVTADQGEALAKELG-IPFIESSAKNDDNVNEIFFTLAK----------LIQEKIDSNKLV 190

  Fly   193 GSQNNRPGN 201
            |..|.:.||
Yeast   191 GVGNGKEGN 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 62/169 (37%)
RAB 9..174 CDD:197555 62/164 (38%)
SEC4NP_116650.1 Rab8_Rab10_Rab13_like 18..183 CDD:206659 64/179 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.