DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB18

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001077675.1 Gene:RAB18 / 840987 AraportID:AT1G43890 Length:212 Species:Arabidopsis thaliana


Alignment Length:200 Identity:70/200 - (35%)
Similarity:111/200 - (55%) Gaps:16/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.||:::|||.|||:||:..:.:..| :....|||.||..|.:.:.::.:.:.||||||||||::
plant    13 LFKVLLIGDSGVGKSSLLLSFTSNTF-DDLSPTIGVDFKVKYLTIGEKKLKLAIWDTAGQERFRT 76

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNL-DSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVS 135
            |..::||||...::|||||..::|.|| |.|..|..:.::.:|...   :::|||||.:: |.||
plant    77 LTSSYYRGAQGIIMVYDVTRRDTFTNLSDIWAKEIDLYSTNQDCIK---MLVGNKVDKESERAVS 138

  Fly   136 TRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALE---LEAEA------EVINDFPDQIT 191
            .:....:.:....: :.|.|||..:|||..|:.:....||   |.||.      .:....|.|.|
plant   139 KKEGIDFAREYGCL-FLECSAKTRVNVEQCFEELVLKILETPSLTAEGSSGGKKNIFKQNPAQTT 202

  Fly   192 LGSQN 196
            ..|.:
plant   203 STSSS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 63/174 (36%)
RAB 9..174 CDD:197555 60/166 (36%)
RAB18NP_001077675.1 PLN03118 1..200 CDD:215587 67/191 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.