DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RABG3B

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_173688.1 Gene:RABG3B / 838880 AraportID:AT1G22740 Length:203 Species:Arabidopsis thaliana


Alignment Length:210 Identity:129/210 - (61%)
Similarity:159/210 - (75%) Gaps:10/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            ||.|:::||||||||||.||||||||||||.:||.||||||||||.|||:.::||:||:||||||
plant     1 MSTRRRTLLKVIILGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTA 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||||||||||||||||||||||....||::||:|.:|||.:||||||..|||::||||||:|
plant    66 GQERFQSLGVAFYRGADCCVLVYDVNHLKSFESLDNWHNEFLTRASPRDPMAFPFILLGNKVDID 130

  Fly   131 ---NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITL 192
               :|.||.::|::||..|.:|.|:||||||..||:.:|..|.|.||..|.:.::... ||   .
plant   131 GGNSRVVSEKKAREWCAEKGNIVYFETSAKEDYNVDDSFLCITKLALANERDQDIYFQ-PD---T 191

  Fly   193 GSQNNRPGNPDNCQC 207
            ||...:.|   .|.|
plant   192 GSVPEQRG---GCAC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 118/172 (69%)
RAB 9..174 CDD:197555 115/167 (69%)
RABG3BNP_173688.1 Rab7 9..180 CDD:206655 117/170 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 259 1.000 Domainoid score I489
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I883
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - otm2572
orthoMCL 1 0.900 - - OOG6_101358
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.