DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAN3

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_200330.1 Gene:RAN3 / 835612 AraportID:AT5G55190 Length:221 Species:Arabidopsis thaliana


Alignment Length:162 Identity:55/162 - (33%)
Similarity:88/162 - (54%) Gaps:7/162 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::|:||...|||:.:.:::...|..:|:.|||.:....:...|...:....|||||||:|..|.
plant    15 KLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLR 79

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRRA 139
            ..:|....|.::::||||..::||:.:|..:..     |..::.|.|:.|||||:.||||..:  
plant    80 DGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLC-----RVCENIPIVLCGNKVDVKNRQVKAK-- 137

  Fly   140 QQWCQSKNDIPYYETSAKEGINVEMAFQVIAK 171
            |.....|.::.|||.|||...|.|..|..:|:
plant   138 QVTFHRKKNLQYYEISAKSNYNFEKPFLYLAR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 55/162 (34%)
RAB 9..174 CDD:197555 55/162 (34%)
RAN3NP_200330.1 PLN03071 1..218 CDD:178620 55/162 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.