DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAN4

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_200319.1 Gene:RAN4 / 835599 AraportID:AT5G55080 Length:222 Species:Arabidopsis thaliana


Alignment Length:163 Identity:53/163 - (32%)
Similarity:87/163 - (53%) Gaps:9/163 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::|:||...|||:.:.:::...|.:..:.|:|.|....:...|...:..:.|||||||::..|.
plant    15 KLLIVGDGGTGKTTFLKRHLTGEFEHNTEPTLGVDIYPLDFFTNRGKIRFECWDTAGQEKYSGLK 79

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSW-RDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRR 138
            .|:|....|.::::||||.:::.|:|.| ||      ..|...:.|.|:.|||||:.:||:..:.
plant    80 DAYYIHGQCAIIMFDVTARHTYMNIDRWYRD------LRRVCKNIPIVLCGNKVDVPSRQIKPKH 138

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAK 171
            ...  ..|..:.|||.|||...|.|..|..:|:
plant   139 VSY--HRKKCLQYYEMSAKNNCNFEKPFLYLAR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 53/163 (33%)
RAB 9..174 CDD:197555 53/163 (33%)
RAN4NP_200319.1 PLN03071 1..219 CDD:178620 53/163 (33%)
Ran 14..179 CDD:206643 53/163 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.