DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RABA4C

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_199607.1 Gene:RABA4C / 834847 AraportID:AT5G47960 Length:223 Species:Arabidopsis thaliana


Alignment Length:183 Identity:66/183 - (36%)
Similarity:109/183 - (59%) Gaps:14/183 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            :.||:::|||:|||:.|:.::....||.:.|||||.:|.|:.:.::.:.:..||||||||||:::
plant    15 VFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDRKTIKAQIWDTAGQERYRA 79

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136
            :..|:||||...:||||:|...||.::..|.:|....|.    .:...:::|||.||.. |.|.|
plant    80 VTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHAD----KNIVIMLIGNKTDLGTLRAVPT 140

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAF--------QVIAKNALELEAEAE 181
            ..|:::.|.:| :.:.||||.:..|||.:|        ::::|..|....|.|
plant   141 EDAKEFAQREN-LFFMETSALDSNNVEPSFLTVLTEIYRIVSKKNLVANEEGE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 64/178 (36%)
RAB 9..174 CDD:197555 63/173 (36%)
RABA4CNP_199607.1 Rab11_like 13..177 CDD:206660 62/166 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.