DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RHA1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001330210.1 Gene:RHA1 / 834549 AraportID:AT5G45130 Length:208 Species:Arabidopsis thaliana


Alignment Length:161 Identity:65/161 - (40%)
Similarity:95/161 - (59%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLGVA 76
            ::|||...||:||:.::|..:|....::||||.|.::.:.|||..|..:|||||||||:.||...
plant    22 VLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPM 86

  Fly    77 FYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVD-LDNRQVSTRRAQ 140
            :||||...::|:|:|...||:....|..|...|.:|    :....:.|||.| ||.|:||...|:
plant    87 YYRGAAAAIIVFDITNQASFERAKKWVQELQAQGNP----NMVMALAGNKADLLDARKVSAEEAE 147

  Fly   141 QWCQSKNDIPYYETSAKEGINVEMAFQVIAK 171
            .:.| :|.:.:.|||||...||:..|..|||
plant   148 IYAQ-ENSLFFMETSAKTATNVKDIFYEIAK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 65/161 (40%)
RAB 9..174 CDD:197555 65/161 (40%)
RHA1NP_001330210.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.