DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RABG1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_568566.1 Gene:RABG1 / 833958 AraportID:AT5G39620 Length:204 Species:Arabidopsis thaliana


Alignment Length:207 Identity:100/207 - (48%)
Similarity:135/207 - (65%) Gaps:8/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69
            :|:.||:|:||||.||||||:.:|.:|.|...:.:||..|..|||:.:.:|.|.:||||||||||
plant     2 EKTKLKIILLGDSGVGKTSLLKRYNDKDFKQLHNSTIYVDLVTKEICIAERQVILQIWDTAGQER 66

  Fly    70 FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN--- 131
            |:||...|||..|||||||||....:|:::|:|.|||:.||:|..|..||||::|||.|::|   
plant    67 FKSLPSRFYRDTDCCVLVYDVNTLKTFESIDNWHDEFIKQANPETPTKFPFVLMGNKTDVNNGKP 131

  Fly   132 RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQI-TLGSQ 195
            |.|:...|.|||.||.:|.|:|||||..||||.||..|||.||..|.:.:.:..:...: |:..:
plant   132 RVVAKEIADQWCGSKGNIVYFETSAKAKINVEEAFLEIAKKALTNERQIDDMERYRSVVPTIEKE 196

  Fly   196 NNRPGNPDNCQC 207
            ..|    ..|.|
plant   197 TPR----SRCSC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 95/172 (55%)
RAB 9..174 CDD:197555 92/167 (55%)
RABG1NP_568566.1 P-loop_NTPase 6..179 CDD:393306 95/172 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.