DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RABA4B

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_195709.1 Gene:RABA4B / 830160 AraportID:AT4G39990 Length:224 Species:Arabidopsis thaliana


Alignment Length:207 Identity:69/207 - (33%)
Similarity:113/207 - (54%) Gaps:26/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAG 66
            ||:...:.||:::|||:|||:.|:.::....||...|||||.:|.|:.:.:..:.:..|||||||
plant    11 SGKVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWDTAG 75

  Fly    67 QERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-D 130
            |||::::..|:||||...:||||:|...:|:::..|.:|....|.    .:...:::|||.|| |
plant    76 QERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHAD----KNIVIILIGNKSDLED 136

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVI------AKNALELEAEAEVINDFPDQ 189
            .|.|.|..|:::.: |..:.:.||||....|||.:|..:      ..|...|.:|.:        
plant   137 QRAVPTEDAKEFAE-KEGLFFLETSALNATNVENSFNTLMTQIYNTVNKKNLASEGD-------- 192

  Fly   190 ITLGSQNNRPGN 201
                  :|.||:
plant   193 ------SNNPGS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 63/176 (36%)
RAB 9..174 CDD:197555 62/171 (36%)
RABA4BNP_195709.1 PLN03110 15..223 CDD:178657 67/203 (33%)
Rab11_like 15..179 CDD:206660 61/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.