DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ARA7

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_193699.1 Gene:ARA7 / 827706 AraportID:AT4G19640 Length:200 Species:Arabidopsis thaliana


Alignment Length:171 Identity:68/171 - (39%)
Similarity:100/171 - (58%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAG 66
            :|.|....|:::|||...||:||:.::|..:|....::||||.|.::.:.|||..|..:||||||
plant     4 AGNKSINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAG 68

  Fly    67 QERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVD-LD 130
            |||:.||...:||||...::|:|||...||:....|..|...|.:|    :....:.|||.| ||
plant    69 QERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNP----NMVMALAGNKSDLLD 129

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAK 171
            .|:|:...||.:.| :|.:.:.|||||...||:..|..||:
plant   130 ARKVTAEDAQTYAQ-ENGLFFMETSAKTATNVKEIFYEIAR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 66/164 (40%)
RAB 9..174 CDD:197555 66/164 (40%)
ARA7NP_193699.1 Rab5_related 10..172 CDD:206653 66/165 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.