DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RABB1a

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_193449.1 Gene:RABB1a / 827427 AraportID:AT4G17160 Length:205 Species:Arabidopsis thaliana


Alignment Length:192 Identity:69/192 - (35%)
Similarity:110/192 - (57%) Gaps:17/192 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |.||:||:.|||:.|:.::.:|||...:..|||.:|..|.:.::::.:.:|||||||||.|:|:.
plant     8 KYIIIGDTGVGKSCLLLKFTDKRFQAVHDLTIGVEFGAKTITIDNKPIKLQIWDTAGQESFRSVT 72

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVSTRR 138
            .::|||....:||||:|...:|.:|.||.:|....||    ::...:::|||.|| |.|.|||..
plant    73 RSYYRGRAGTLLVYDITRRETFNHLASWLEEARQHAS----ENMTTMLIGNKCDLEDKRTVSTEE 133

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPG 200
            .:|:.: ::.:.:.|.|||...|||.||         :|..|.:.....|.:.  .:.|.||
plant   134 GEQFAR-EHGLIFMEASAKTAHNVEEAF---------VETAATIYKRIQDGVV--DEANEPG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 64/169 (38%)
RAB 9..174 CDD:197555 63/164 (38%)
RABB1aNP_193449.1 PLN03108 1..204 CDD:178655 69/192 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.