DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RABG3A

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001154217.1 Gene:RABG3A / 826558 AraportID:AT4G09720 Length:217 Species:Arabidopsis thaliana


Alignment Length:222 Identity:126/222 - (56%)
Similarity:156/222 - (70%) Gaps:20/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            |:.|:::|||||:||||.|||||||||||:|:||.||||||||||.|||:.:.:::||:||||||
plant     1 MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQIWDTA 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQ-----------ASPRDPDHFP 119
            |||||||||.|||||||||.|||||....||.||::|.:|||.|           |||.||..||
plant    66 GQERFQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQAWNIGMWTIAEASPSDPKTFP 130

  Fly   120 FVVLGNKVDLD---NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAE 181
            |:|||||:|:|   :|.||.::|..||.|..:|||:|||||:..||:.||..|||.||..|.|.:
plant   131 FIVLGNKIDVDGGSSRVVSDKKAADWCASNGNIPYFETSAKDDFNVDEAFLTIAKTALANEHEQD 195

  Fly   182 V-INDFPDQITLGSQNNRPGNPDNCQC 207
            : ....||.:|   :|...|.  .|.|
plant   196 IYFQGIPDAVT---ENEPKGG--GCAC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 115/183 (63%)
RAB 9..174 CDD:197555 112/178 (63%)
RABG3ANP_001154217.1 Rab7 9..193 CDD:206655 115/183 (63%)
RAB 9..190 CDD:197555 114/180 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 259 1.000 Domainoid score I489
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I883
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - otm2572
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1058
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.