DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB7B

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_188512.1 Gene:RAB7B / 821415 AraportID:AT3G18820 Length:206 Species:Arabidopsis thaliana


Alignment Length:210 Identity:139/210 - (66%)
Similarity:168/210 - (80%) Gaps:7/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            |..|:::||||||||||.|||||||||||||:|||||||||||||.||||...||:.|:||||||
plant     1 MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTA 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||||||||||||||||||||||.:..||:||::||:||||||||.||::||||::|||||:|
plant    66 GQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPFVLIGNKVDVD 130

  Fly   131 ---NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITL 192
               :|.||.::|:.||.||.:|||:|||||.|.|||.|||.|||:||:...|.|:.  .||.|.:
plant   131 DGNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELY--LPDTIDV 193

  Fly   193 GSQNNRPGNPDNCQC 207
            |:.|.:  ....|:|
plant   194 GTSNQQ--RSTGCEC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 127/172 (74%)
RAB 9..174 CDD:197555 125/167 (75%)
RAB7BNP_188512.1 Rab7 9..182 CDD:206655 127/172 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 259 1.000 Domainoid score I489
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I883
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - otm2572
orthoMCL 1 0.900 - - OOG6_101358
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.